Sign In | Join Free | My
Search by Category
Wholesale Marketplace
Home >



All Environment wholesalers & Environment manufacturers come from members. We doesn't provide Environment products or service, please contact them directly and verify their companies info carefully.

Total 60675 products from Environment Manufactures & Suppliers
Cheap Pure water treatment system for sale

Categories:Water Treatment


Silica sand filter(SYS), precision (SFJ), fiber active carbon filter (SS), Sodium-ion exchanger (SN2), hollow fiber filter (FY), UV sterilizer ozone generator and other equipments' treating capacity is 2-30 ton/hr. It can effectively get rid of muddy ...

ICP Remarked Supplier

Cheap Green Color LED Pharmacy Cross Signs 110V FARMACIA Cross Customized for sale

Brand Name:CGX

Model Number:PH001

Place of Origin:Guangzhou, China

Green Color LED Pharmacy Cross Signs 110V FARMACIA Cross Customized 1. Details: Double sides Waterproof function Outdoor use Length can be customized European power or can be customized Plastic sheeting -40-70 degreen working temperature Letters can be ...

Guangzhou Baiyun CGX Electronic Factory
Active Member

Cheap Metal screen wall panel for hotel lobby curtain wall decoration for sale

Brand Name:Screen Partition

Model Number:stainless steel,aluminum,brass,metal

Place of Origin:china supplier metal screen

Metal screen wall panel for hotel lobby curtain wall decoration​ CAD DRAWING WELCOME TO QUOTE. SCREEN PARTITION / ROOM DIVIDER/WALL PANEL/LASER CUT SCREEN 1.Material:stainless steel, carbon steel, aluminum,brass 2.finish:8k mirror,no4 satin,brushed,...

Foshan Xin Tai Jia Stainless Steel Co.,Ltd
Site Member


Cheap Vertical Cardboard Baler and Horizontal Cardboard Baler for sale


Place of Origin:CHINA

For cardboard baling, both vertical cardboard baler and horizontal cardboard baler are good baling solutions. Capacity, price, space limitation and labor cost are four main factors you need to consider when you choose vertical cardboard compactor and ...

SINOBALER Machinery Company Limited
Active Member

Cheap Cheapest Wholesale Kids Silicone Slap Watches for sale

Brand Name:Seeteng

Model Number:Silicone Slap Kids Watch


Product Description Cheapest Wholesale Kids Silicone Slap Watches Item No: Silicone Slap Kids Watch Case Material: Alloy (inside) + silicone(outside) Case-back: stainless steel Movement: Chinese/Japanese strap material: Silicone MOQ: 1000pcs Dimension: L:...

Site Member


Cheap Biometric Rugged Tablet PC M8 with Optical Fingerprint Scanner, Smart Card Reader and RFID Card Reader for sale

Brand Name:EKEMP

Model Number:M8

Place of Origin:China(Mainland)

Biometric Rugged Tablet PC M8 with Optical Fingerprint Scanner, Smart Card Reader and RFID Card Reader Product Description Key features: • Cutting edge fingerprint verification tech • 8 inches capacitive multi touch screen • High volume 8000mAh ...

Active Member

Cheap Original   Philips 10 lead ecg trunk cable ,M1663A for sale

Brand Name:Philips

Model Number:M1663A

Original Philips 10 lead ecg trunk cable ,M1663A Other original Philips accessories are available.

HongKong BiocareMed Co.,Ltd
Site Member


Cheap Prefessional Super Long time Running Camping LED Flashlight Torch for sale

Brand Name:Kingfory

Model Number:M5LR

Place of Origin:CHINA

M5LR camping flashlight Charging Voltage: AC100~240V Working Frequency: 50/60Hz Bulb:well-chosen from USA Large Capacity LED+ SMD LED Color: white + red Material: aircraft grade alloy aluminum + PC cover Max. Luminous Flux: high-light 200 lm Powered by: ...

Dongguan Sunshine Electronics Co Ltd
Active Member


Cheap Brominated Polystyrene for sale

Brand Name:aner

Brominated Polystyrene Application:This flame retardant provides outstanding thermal stability and electrical performance. It is particularly suitable for engineering plastic applications such as polyesters(PET,PBT,PCT)and polyamides(nylons).It has ...

Active Member

Cheap Water Pump sewage dirty water pump OK80-25S / OK100-30S for sale

Categories:Mineral Water Bottle Caps



sewage dirty water pump OK80-25S / OK100-30S Detailed introduction

ICP Remarked Supplier


Cheap Civil purifier BSF1-100 pre-filter backwash for sale

Categories:DC Regulated Power Supply



Operated by the company's products are widely used in factories, offices, restaurants, government offices and home, etc. We provide customers with drinking water filtration, air purification, building insulation explosion-proof film a one-stop total ...

Shantou Haolishi Trade Co., Ltd
ICP Remarked Supplier


Cheap Ftth gepon EPON 1GE WIFI onu ONT EPON FTTx with 300Mbps Wifi antenna for sale

Brand Name:V-SOL

Model Number:V2801HW

Place of Origin:CN

Ftth gepon EPON 1GE WIFI onu ONT EPON FTTx with 300Mbps Wifi antenna V2801HW 1GE+WiFi EPON ONU is designed for fulfilling FTTH and triple play service demand of fixed network operators or cable operators. It meets telecom operators FTTO (office), FTTD (...

Guangzhou V-SOLUTION Telecommunication Technology CO., Ltd
Active Member


Cheap HITACHI EX300-1 EX300-2 EX300-3 EX300-5 gear pump pilot pump charge pump for excavator for sale

Brand Name:Sailfish

Model Number:EX300-1 EX300-2 EX300-3 EX300-5

Place of Origin:CHINA

HITACHI EX300-1 EX300-2 EX300-3 EX300-5 gear pump pilot pump charge pump for excavator contact imfoemation:

Sailfish Machinery&Equipment co.,ltd
Site Member


Cheap oil-sludge-treatment-equipment for sale

Categories:Mineral Water Bottle Caps


oil-sludge-treatment-equipment Author:Hengchuang Environmental Date:2017-01-06 Previous:/Back to list Next:oil-sludge-garbage-treatment-plant

Shangqiu Hengchuang Environmental Protection Technology Co., Ltd.
ICP Remarked Supplier

Cheap High pure Sermorelin Acetate white color powder with fast delivery from Chinese reliable supplier for sale

Brand Name:Youngshe

Model Number:high quality

Place of Origin:China

Sermorelin Acetate Name: Sermorelin Acetate Cas No: 86168-78-7(net),114466-38-5(acetate) Formula: C151H250N44O44S Molecular:3417 Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQ Purity:98% Appearance: white powder Source: synthetic Also known as: Geref, UNII-...

Chengdu YoungShe Chemical Co., Ltd
Active Member


Cheap Lathe TY-AL1525 for sale

Categories:Other Series

Telephone:86 769 85269659


Click thumbnails to enlarge Lathe TY-AL1525 Machine Characteristic Spindle made in TaiWan can be sure the lathe run smoothly and placidly ! Lathe duty body is made of high-strength meehanite cast iron ensure the stability and balance of the running lathe...

DongGuan TaiYang Precision Machinery Co., Ltd
ICP Remarked Supplier

Cheap cooking oil for sale

Categories:2 Wheel Self Balancing Electric Vehicle

Telephone:00966 126110604


Diyah Cooking Oil upload/product/143478709618964.png Taste the Exotic Flavor...

Omani Vegetable Oils & Derivatives limited
ICP Remarked Supplier

Cheap ZW type self sucking non clogging sewage pump for sale

Categories:Stainless Steel Check Valve

Telephone:(86)021-64582626 64588099


Product overview Zwtype Self-priming sewage pump is the division according to the ZX type self-priming centrifugal pump and QW type submersible sewage pump, the structure and the performance of, from the advantages of similar foreign products developed a...

Shanghai Yimin Electric Machine CO.,LTD.
ICP Remarked Supplier

Cheap Elegant for sale

Model Number:60EL53301

Place of Origin:China

Brand Name:Bueno Grifo

Elegant Shower mixer brass mainbody 35 cartridge zinc handle

Taizhou Bueno grifo sanitary Co. Ltd
Site Member


Cheap Underwater ROV VVL-V600-4T,200M Diving Depth,600M optional,Customized Robot For Sea Inspection and Underwater Project for sale

Brand Name:VVLAI

Model Number:VVL-V600-4T

Place of Origin:China

Underwater ROV VVL-V600-4T 1.Product image 2.Presention Underwater ROVs are completely mobile underwater camera systems that are cntrolled from the surface and capable of staying submerged indefinitely.These ROVs are ideally suited to a variety of ...

Shandong Future Robot Co.,Ltd
Site Member


Go to Page
Inquiry Cart 0